The Ghost Rider’s First Ride | Ghost Rider (2007)

  Переглядів 16,103,503

NOW PLAYING

NOW PLAYING

Рік тому

GHOST RIDER (2007) is NOW PLAYING and can be found to Rent or Buy here: DP.SonyPictures.com/GhostRider
Find the sequel here: DP.SonyPictures.com/GhostRider...
When motorcycle rider Johnny Blaze sells his soul to the Devil to save his father's life, he is transformed into the Ghost Rider, the Devil's own bounty hunter, and is sent to hunt down sinners.
Watch More:
► Need a Smile? Subscribe to Now Laughing: bit.ly/39UENSw
► Need a Fright? Subscribe to Now Scaring: bit.ly/39UENSw
► Have less time? Subscribe to Shorts: bit.ly/39UENSw
NOW SCARING is a channel made for movie fans, by movie fans. Here you will find all of the most memorable moments, scenes, trailers, and more from all of your favorite horror films.

КОМЕНТАРІ: 3 300
@yommish
@yommish Рік тому
“You’re going down” “Sorry, all outta mercy” Brilliant writing
@allighast9714
@allighast9714 Рік тому
It's like they wrote both lines expecting them to choose one for the final draft and then they just gave it to the other car instead
@Dennis_Reynolds
@Dennis_Reynolds Рік тому
Shakespearean levels of writing.
@graememontrose1741
@graememontrose1741 Рік тому
Yeah, for the latter i woulda gone with "I am the Spirit of Vengeance...don't ask me for mercy."
@LegacyKnight-zm6vz
@LegacyKnight-zm6vz Рік тому
Gressil: Have mercy Ghost Rider: Didn’t say “please”. Maybe not the best, but better IMO lol
@BigBoss-dt4jv
@BigBoss-dt4jv Рік тому
Didn"t knew the Rider should be so eloquent...
@iamajay3333
@iamajay3333 Рік тому
No CGI just real life scenes captured by cameras. Nicolas cage is a legend
@jeremygray462
@jeremygray462 Рік тому
always
@jasonabraham6061
@jasonabraham6061 Рік тому
He really is every movie especially those thrillers are so good
@cre7701
@cre7701 Рік тому
@@kronos4669 tu chu h ..sarcasm tha uska comment
@blarginsnitchal
@blarginsnitchal Рік тому
@@epicawesome5464 More!!
@TheBlueShark
@TheBlueShark Рік тому
Can't believe Nicholas Cage actually had to burn all his skin and organs off just for this role
@jaseem4356
@jaseem4356 21 день тому
Anyone watching in 2024?
@jesuranjesu3708
@jesuranjesu3708 16 днів тому
Yes sit🥷
@KaranKumar-wm1il
@KaranKumar-wm1il 15 днів тому
Yes lot of people are watching this video in 2024
@MusicOfficial-pg3lw
@MusicOfficial-pg3lw 15 днів тому
Ayooo
@inc7892
@inc7892 14 днів тому
Hell 🥵🥵Yeah
@HarisKhan-nw7hl
@HarisKhan-nw7hl 14 днів тому
No im from 1673
@Illuminatty1
@Illuminatty1 4 місяці тому
"He ain't so tough" gets hit with one punch n says have mercy 😂😂💀
@thanhaislam1810
@thanhaislam1810 3 місяці тому
😡😡
@AMETHYST21897
@AMETHYST21897 2 місяці тому
“Sorry. All out of mercy.”
@dude-jk2hn
@dude-jk2hn 2 місяці тому
But how did GR survive that truck?
@AMETHYST21897
@AMETHYST21897 Місяць тому
@@dude-jk2hn when you think real hard about it the Ghost Rider is actually a spirit. Perhaps its hellish powers allowed it (and by extension, Johnny Blaze) to survive the truck crash unharmed ?
@mirandaalifkarim3420
@mirandaalifkarim3420 Місяць тому
Ghost Riders can t be k illed by anything exc ept holy weapons
@Christoph1712
@Christoph1712 Рік тому
3:39 As a Biker I can confirm that this is what it feels like to go for the first ride after winter break :D
@gumballer133
@gumballer133 Рік тому
That's how I feel every year when I get on my Turbo 2 stroke snowmobile again. Haha.
@amitthapliyal9787
@amitthapliyal9787 Рік тому
U really had winter break...its just oosome feeling riding in winter in hills with sunshine...
@trevorsawyer2272
@trevorsawyer2272 Рік тому
It does it so does
@aamirhoda7363
@aamirhoda7363 Рік тому
Damn yeahhh 🔥🔥🔥🔥
@COMEDIC_EDDIE
@COMEDIC_EDDIE Рік тому
Hahaha...every day after work
@dolphinsfan3245
@dolphinsfan3245 Рік тому
Say what you want about this movie, but Nic cage killed it in this role. Especially this first transformation scene. Epic !
@BonifaceJoseph
@BonifaceJoseph Рік тому
LMAO, No.....its a shit movie
@Philip_023
@Philip_023 Рік тому
Yeah... One of the best adaptations from Marvel
@jeremygray462
@jeremygray462 Рік тому
@@BonifaceJoseph what r u for real
@greatninja2590
@greatninja2590 Рік тому
@Most Heinous Gamer ! nah it is a bad film acting was okay would have benefit with competent writer though.
@neardarkroad1347
@neardarkroad1347 Рік тому
@@greatninja2590 it is no masterpiece, that is for sure...but it is still a fun movie to watch
@user-qc1ub7mb2z
@user-qc1ub7mb2z 6 місяців тому
In 5:54 to 6:19 , It was still Johnny, screaming in pain. But in 6:20, it was already the Rider being glad and happy to be freed again in a new vessel.
@brennanhunt2722
@brennanhunt2722 24 дні тому
I wouldn't say he was in a "new vessel"; I'd just say the Spirit of Vengeance is back on earth. Anyone could become the Ghost Rider, it just depends on what possesses you!
@akiharashuguro2141
@akiharashuguro2141 4 дні тому
​@@brennanhunt2722 i still don't get it
@jokerinthebronx
@jokerinthebronx 12 годин тому
Cage improvised the laughing. He was really into the character.
@Raigoth
@Raigoth 9 місяців тому
The transformation scene is so accurate as to what might happen to someone in that amount of pain. While not as bad as it is to burn like he did from the inside out, I once experienced the same type of thing happen. I dislocated my left knee and instantly was on the ground. Pain was so bad that all I could do was laugh. Thought I was going crazy.
@livinglegend9709
@livinglegend9709 Місяць тому
Well one coukd say that zatharos( the angle of vengeance inside cage) is coming out. Since zatharos is pretty much insane, those laughs could be him being happy hes finally been released
@alexcorrales7322
@alexcorrales7322 Місяць тому
Calm down edgelord
@Raigoth
@Raigoth Місяць тому
@alexcorrales7322 I'm perfectly calm. Not sure how describing my own pain as well as giving an opinion on a movie makes me an "edgelord" wanna elaborate or are you just here to try and be a troll of some sort?
@caramellpanda
@caramellpanda Рік тому
This movie was pretty raw for a 2000s movie, it still holds up pretty well and Peter Fonda did an incredible job as Mephistopheles.
@torquetheprisoner
@torquetheprisoner Рік тому
he was in easy rider
@jamessantiago2682
@jamessantiago2682 Рік тому
More like Mephistopheles did an incredible job as Peter Fonda
@ashirvadin
@ashirvadin Рік тому
As did Ghost Rider as legendary Nicolas Cage.
@vladimirmarianoreis8353
@vladimirmarianoreis8353 Рік тому
aLp
@chairthing
@chairthing Рік тому
Acting opposite a Coppola, you need to go all in
@mjkhan9664
@mjkhan9664 Рік тому
15 years later and this is still one of the coolest moments in marvel films. Just imagine this version of Ghost Rider in the MCU. Also Nicolas Cage always did have a way to just slay the crazy moments and that transformation really did show his abilities quite well
@Deinobi
@Deinobi Рік тому
let's be honest here, whatever Disney can cook up right now could never be as cool as this
@Yodoggy9
@Yodoggy9 Рік тому
@@Deinobi I disagree; if Disney could work Cage into being an older Ghost Rider, like the cowboy one we get in this movie, it could easily surpass the cool factor! They’ve got the money for it, too!
@darkvoid3182
@darkvoid3182 Рік тому
@@Yodoggy9 disney only cares about money not the community
@dasunwilson8610
@dasunwilson8610 Рік тому
ukposts.info/have/v-deo/b3mneZ6DhXllr4k.html🥰
@Papa_Straight
@Papa_Straight Рік тому
@@Yodoggy9 yeah they would cast a female ghost rider and make all the males look bad
@oddfreaks6452
@oddfreaks6452 Рік тому
Man I love how they didn’t use CGI for the transformation and instead just let Nicholas Cage use his own innate talent.
@drzen7703
@drzen7703 9 місяців тому
Cage's performance is so perfect, so sad it didn't hit. wish to see more cage play as role of superhero. he deserve more.
@beukenphom3680
@beukenphom3680 Рік тому
That laugh from Johnny is just amazing ...it's not him but the Rider inside him waiting to come out after a long time that's what makes him to laugh !!!!
@reixie
@reixie Рік тому
u mean vengeance?
@superyoshiemonster3008
@superyoshiemonster3008 Рік тому
Like johnny himself is screaming in mortifying pain while the rider is laughing, finally being out again after years of being hidden, it makes sense because at first Johnny is screaming in pain and doesnt know what's going on but when his skull is exposed and in flames he turns to sudden laughter, amazing writing and acting, amazing
@ryanroubert2483
@ryanroubert2483 Рік тому
Not a rider inside Johnny. He was possessed by Nicholas Cage
@potatoechip2757
@potatoechip2757 Рік тому
Ahaha😂
@Mash3OH3
@Mash3OH3 Рік тому
It’s laughing at Johnnys futile attempt at trying to resist it lol
@Simmychann
@Simmychann Рік тому
Damn I remember watching this movie everyday after elementary school now I’m 21 and this shit still go hard
@chasethemoney6129
@chasethemoney6129 Рік тому
Facts makes me wanna ride
@Simmychann
@Simmychann Рік тому
@@chasethemoney6129 fr fr
@jackthecommenter2768
@jackthecommenter2768 Рік тому
@@Simmychann fr fr fr
@KhaledMohamed-is5pl
@KhaledMohamed-is5pl Рік тому
Yea I am 28
@AdrienRBLX
@AdrienRBLX Рік тому
Same bro btw I'm 18 now
@bradycampbell5321
@bradycampbell5321 10 місяців тому
16 years later, and this is STILL one of the most well put together sequences in any marvel movie
@kevinlockhart2000
@kevinlockhart2000 8 місяців тому
6:43 I can only hear "spongebob is faithful" and I might never be able to unhear that.
@lonelyboyandhistelephone5697
@lonelyboyandhistelephone5697 Місяць тому
Damn you Now I can't unhear it
@abdizur8765
@abdizur8765 Рік тому
I really hope Nick's version of Ghost Rider exists somewhere out in the Multiverse for the MCU.
@Jmzhockey92
@Jmzhockey92 Рік тому
no doubt
@Cerdo_asqueroso
@Cerdo_asqueroso Рік тому
Nicholas Cage should never ever be ghost rider. The only reason why he was in this role was because he annoyed the director day and night to get the role, but that role was supposed to be for Jhonny Depp.
@Antwannnn
@Antwannnn Рік тому
He does. Everything goes. Even you 😉
@Luka2000_
@Luka2000_ Рік тому
@@Cerdo_asqueroso no need to spam the comments
@iceberg6140
@iceberg6140 Рік тому
@@Cerdo_asqueroso in all honesty I don’t think Johnny Depp would have suited the role of this character, nic performed perfectly he’s got that badass look to him and I think he pulled it off being the ghost rider I don’t think I can see Johnny being that sort of badass type. You have to admit we can’t unsee Nicolas as not being ghost rider. Despite how he got the role I 100% agree he nailed it for sure. Good on him👍🏻
@OfentseMwaseFilms
@OfentseMwaseFilms Рік тому
Why did this movie receive so much hate? It looks Great
@Jairah0613
@Jairah0613 Рік тому
Don't care about the haters care about the lovers
@user-vr8fs8gg6h
@user-vr8fs8gg6h Рік тому
It looks awfull dont lie
@ameybirulkar7503
@ameybirulkar7503 Рік тому
@@user-vr8fs8gg6h still much better than fat Thor and professor hulk
@user-vr8fs8gg6h
@user-vr8fs8gg6h Рік тому
@@ameybirulkar7503 that sucks aswell but so does this
@ameybirulkar7503
@ameybirulkar7503 Рік тому
@@user-vr8fs8gg6h no
@davideromano627
@davideromano627 7 місяців тому
The ghost rider's trasformation was like something beyond hell
@Artisan1979
@Artisan1979 7 місяців тому
9:42 changing the sound of the engine to something demonic works perfectly
@xManAvenger
@xManAvenger Рік тому
His transformation scene still gives me goosebumps, the cgi still holds up!!
@deadpool3466
@deadpool3466 Рік тому
for now...
@endeliggnist5066
@endeliggnist5066 Рік тому
You're kidding, right?
@xManAvenger
@xManAvenger Рік тому
@@endeliggnist5066 I mean the transformation, like with his skin melting… not the ghost rider cgi.
@mamigyllenhaal2726
@mamigyllenhaal2726 Рік тому
​@@xManAvengerdon't you know? That particular scene was completely improvised by Nic Cage, no CGI or whatever, the man simply unleashed his inner Cage, seeing this, the director just kept on filming, and his decision clearly paid off.
@truongduynguyen3365
@truongduynguyen3365 Рік тому
​@@mamigyllenhaal2726 jqvfkdkkdkflfmkckfkfkfkkkkfkdikriirifirfkfxjjdjdjxjdkdkkddkkfrkfifkeiirfiieeiieifeifidiriddjrjkfrjfkrifkrifiririirjrirriirrjritkrkrrifkfjfiififijrrjrirfiriirririirifrjrirfirifirririirfirigirriitk😢❤😢😢😅😅😅😅😅😅😅😢😢😢😢😢😢😢😢😢😢😢😢😢🎉🎉🎉🎉😢😢😢😢😢😢😢😢😢kkdkfkrkiekdjdjdjiiddiififififjfifirfiririir😂y😢😮😮😮😮😮😮😢😮😮😢😢😢diiiidifiidififiifodorororroifjfrdidrjrifidifiifififdideirirrieisksiiswieieeieiddieiisieiieeeieieidieeeiieidieeiiieieieieeiiieeieeeieddieiririeieieieiieifoerere😂😂😊😅😊😊😊😊😊😊😊😊😊😊😊😊😊kdeiiddriridiriirrrrririrriirioroeoroerriiorrirrirririririeiirriirimhullggvkklfdjjkjjhhigdfgvjugzvcffffffbhggggffvgfgbgggnbhhjjhhhhhjjhhffgnkyhkjrdjyrfhhhgjjhhbggngfbhjnnjhtrnjhhhgbvvggjjgfffcdffffjifddhjjjddfmkm GvcdsssaZ😙😆😅🤣😀😍😭😁😅😆😅🥰🤩😊😍🥰😀😃😃😭😀🥰🥰😍🤩🤩😭🤣😆😘😂😊😅😘😆😁😁😀rhhhjbghnrbhnhghjhhhhhlheenhggffffgjyhrbregedhegretheefgerherbrgbrrtgggggffmmgdwqqwhkujjkkiookiiioigreseesghjjjjhfewqqjukjjjjyjjjtewqaaskouteyfhjiurrsdfhjiyyuffrrfjgyhggyygggttthrgbrgrghgrrrgfrrrrrrrffffffttrrreruiueueeueueeudeudeucrsnidjejjenjcejxjdjxeifrkicekidejiwiiedjsidjexidieijdcjdjejxjdsjxieidsidjjjjuwiejiedididiwiieiwidieisiudjdudidieisisidideiwixiweisieieoediidieekedkdkdoidididdiddjdjdi
@DrJekyll38
@DrJekyll38 Рік тому
This was by far the most malevolent character Peter Fonda ever played, but he pulled it off like no one else could. May an amazingly good actor rest in peace.
@richie9308
@richie9308 Рік тому
He really carried the film I thought.
@debojitdowarah
@debojitdowarah 8 місяців тому
জন দদভথলযতথযমতথথণচ
@randompat5772
@randompat5772 Рік тому
Anyone else love the soundtrack in this film? Especially those dark guitar riffs like at 1:28. Christopher Young doesn't get enough credit for his work. He also did the music for Spider-Man 3 btw.
@alcoholically4280
@alcoholically4280 6 місяців тому
You can tell that transformation was PAINFUL asf. From the first *GAHH* like he was literally getting burned away from the inside. They/Nick Cage did a great job at showing the pain Johnny was experiencing. Ik that had to have been literal torture especially with Zarathos taking over
@SlapperTV
@SlapperTV Рік тому
Great movie, just one thing annoying is that it doesn’t show the true power of the Ghost Rider. Literally one of the few Marvel characters to take out Thanos but for a 2000s movie this movie was great!
@ludvighstrup4266
@ludvighstrup4266 Рік тому
This is not great movie not 2000 movie is 2007 movie
@Dante-tb7gc
@Dante-tb7gc Рік тому
Lmao it’s necessary to nerf OP characters buddy. Imagine if Lucifer(Netflix) was in accordance with his true powers per comics. There’d be no drama, no plot.
@SlapperTV
@SlapperTV Рік тому
@@ludvighstrup4266 I meant as in a 2000s movie
@SlapperTV
@SlapperTV Рік тому
@@Dante-tb7gc Why do they need to nerf him? If they brought the Ghost Rider back to the current MCU there’s quite a few opponents they can have challenge him and still have a great plot… Even tho Mephisto and his son were the main enemies in the comics and in these movies there are other powerful rivals of the Ghost Rider that they can make bad ass with the Cinematic Universe version 🤷‍♂️
@brucesbanner5057
@brucesbanner5057 Рік тому
Good for a 2000 movie lol. Bruh this is 2007. you do know movies like Lord of the Rings and The Matrix were already out by now. This movie is garbage and looks like a group of kids made it for highschool drama class. The story, the cgi, the acting. All terrible.
@ohdannyboy9675
@ohdannyboy9675 Рік тому
That motorcycle transformation at 9:15 is way more wicked than I remember Ghost Rider rocks!
@evolve_exo2133
@evolve_exo2133 11 днів тому
I remember my dad showing me this movie in 2003 still a ghost rider fan today
@soulfulfool
@soulfulfool Рік тому
that bike transformation never gets old
@amogh_theone
@amogh_theone 6 місяців тому
This movie was gorgeous, I still came back to watch this scene over and over. It bring certain level of satisfaction inside of me that I can't articulate in human sense.
@AlanKaroff
@AlanKaroff Рік тому
Nicolas Cage perfectly portrayed the burning alive from the inside. No one, I repeat - NO ONE could do that.
@Json13th
@Json13th Рік тому
I can
@shadowfor1995
@shadowfor1995 Рік тому
I did it yesterday lol big deal
@thanqualthehighseer
@thanqualthehighseer Рік тому
Have you never had a extra spicey Taco meal?
@ooofsized2036
@ooofsized2036 Рік тому
most people can lol
@FireTotodile
@FireTotodile Рік тому
diarrhea
@manugulati1105
@manugulati1105 Рік тому
One of the greatest acting performances I’ve ever witnessed. Thank you Nic Cage!
@Cerdo_asqueroso
@Cerdo_asqueroso Рік тому
Nicholas Cage should never ever be ghost rider. The only reason why he was in this role was because he annoyed the director day and night to get the role, but that role was supposed to be for Jhonny Depp.
@aBhi-oz4hu
@aBhi-oz4hu Рік тому
@@Cerdo_asqueroso I like Johny but i don't think he will fit for this role. Nic did a great job
@personalclasslog6972
@personalclasslog6972 Рік тому
@@Cerdo_asqueroso copy pasting the same shit in every thread?
@Cerdo_asqueroso
@Cerdo_asqueroso Рік тому
@@personalclasslog6972 Oh I dont know what you are talking about. Maybe you are crazy, or maybe you saw a bot.
@randomfatman339
@randomfatman339 Рік тому
@@Cerdo_asqueroso nah you said the exact same thing under a different comment
@leeroy5665
@leeroy5665 8 місяців тому
Most believable live action transformation ive ever seen. The water starts to first burn away from his eyes since they have the most exposed mositure. The pain from his body completely burning away, then the euphoria of knowing secrets of the universe while also holding massive anounts of power realizing you now feel the best youve ever felt, all while experiencing the most intense pain you have ever felt, realizing its almost over and going absolutly fucking BALLS TO THE WALL PSYCHO haha.
@BateMasterJeff9887
@BateMasterJeff9887 3 місяці тому
This movie is so underrated. I love it!!!
@akashsunshine7133
@akashsunshine7133 3 місяці тому
No 1can beat this movie in theaters.. 💞🔥turbo
@kobi005
@kobi005 Рік тому
I love this scene, I especially love how he transforms the bike and starts riding it by saying "It's Ghosting Time!"
@Rodney_G2A
@Rodney_G2A Рік тому
Its Rider time
@tommyvercetti1111
@tommyvercetti1111 Рік тому
Ghost rider ghosted me 😤
@Aaleg
@Aaleg Рік тому
It’s ridin’ time
@mr.knight8039
@mr.knight8039 Рік тому
Truly one of the scenes ever
@kevinduliesco5468
@kevinduliesco5468 Рік тому
My crush ghosted me
@abhijitdas2987
@abhijitdas2987 Рік тому
I don't care how bad or good this movie was. All i want is another Ghost Rider movie in MCU but powerful as he is in comics.
@deadinside7002
@deadinside7002 Рік тому
@@SmartIndian_7337 is it good?
@ididntmeantoshootthatvietn5012
@ididntmeantoshootthatvietn5012 Рік тому
​@@deadinside7002 lol when overproud indian people want you to watch that, of course its not good
@princemonzzzi2174
@princemonzzzi2174 Рік тому
@@deadinside7002 nope
@Tenchi707
@Tenchi707 Рік тому
@@ididntmeantoshootthatvietn5012 😂
@unexplainedaf7469
@unexplainedaf7469 Рік тому
@@ididntmeantoshootthatvietn5012 What they say to every Indian man who becomes an actor: Welcome to Bollywood - would like a mustache or a beard?
@azmathahmed2476
@azmathahmed2476 25 днів тому
Greatest scene ever in movies without doubt
@shoulderguy6397
@shoulderguy6397 Рік тому
Johnny: I'm not doing it Devil: you don't have any choice. So badass
@driftersforge4962
@driftersforge4962 Рік тому
I like this version better than the second one. Mainly because the way his skin wad burning of seems like it would translate somewhat well into actual reality.
@furionmax7824
@furionmax7824 Рік тому
But the second is honestly good bc the fire is more realistic looking with the smoke coming off. And the fact that the bike, chain, and his clothes are bubbling like hot tar and charcoal black from the fire instead of this heavy metal looking skull look. It shows how the hellfire coming from Blaze is corrupting everything he's holding instead of just giving it a cool redesign. Zarathos was a corrupted angel of justice. Therefore his fire corrupts anything it touches.
@guyfawkesii7532
@guyfawkesii7532 Рік тому
I agree, but I wish they would have kept his Penance Stare the same as the first movie too, unless they did that to show he's an unstable Ghost rider lol
@Caliif
@Caliif Рік тому
@@furionmax7824 my biggest problem was that they didn't keep it consistent, I like the way he is portrayed in 2 but it's to big of a change looking at the first movie.
@furionmax7824
@furionmax7824 Рік тому
@@Caliif well in the beginning it's implied he's been the rider for a while. He fled to a whole other continent bc he couldn't control zarathos anymore. But the change could've been done better. Like in the first one where his skin burns off. In this one it kind of just transitions I guess.
@Caliif
@Caliif Рік тому
@@furionmax7824 they should have shown how he loses control in a flash back or in the first movie, because here he can control it he just isn't used to it and in the second it's instantly "it's to dangerous, I can't let him out"
@hishamramzan5310
@hishamramzan5310 Місяць тому
This movie is what made Ghost Rider my #1 favorite Marvel hero
@kushunadkat9087
@kushunadkat9087 9 місяців тому
Nic Cage was so perfect for this! We need him again.
@stepanserdyuk4589
@stepanserdyuk4589 Рік тому
It's interesting how both movies have their own ups and downs. If only we could get the third one that would combine the best of two worlds.
@kunalapte5816
@kunalapte5816 Рік тому
Could u elaborate on what things did both movies do best in their own way ? Edit: I'm not mocking tho, just genuinely asking for ur opinion.
@tc-channelhobby4051
@tc-channelhobby4051 Рік тому
Two was shit to be honest, remake the second to fit the first narrative like the game did.
@xtrydelta7596
@xtrydelta7596 Рік тому
needs more metal music
@juju_mitch
@juju_mitch Рік тому
The second one was God awful.
@dasunwilson8610
@dasunwilson8610 Рік тому
ukposts.info/have/v-deo/b3mneZ6DhXllr4k.html
@kahoo.manawanui
@kahoo.manawanui Рік тому
I was 17 when I first watched this movie. The bike transformation scene was always badass to me.
@deadpool3466
@deadpool3466 Рік тому
heh
@christianwilliam3687
@christianwilliam3687 Рік тому
Hello 🤗
@jakobhardy1734
@jakobhardy1734 Рік тому
@@deadpool3466don't you remember the time he penance stared you?
@deadpool3466
@deadpool3466 Рік тому
@@jakobhardy1734 No. I could not see anything cuz my super suit was on me backwards on accident.
@deadpool3466
@deadpool3466 Рік тому
@@jakobhardy1734 what does penance mean? it sounds dangerously close to sounding like penis. Im worried.
@godzilla0974
@godzilla0974 5 місяців тому
That’s one hell of an entrance.
@kyrusbrightfuljr.2830
@kyrusbrightfuljr.2830 2 місяці тому
I loved this movie. Way better then part 2. This was a classic, just like fantastic 4.
@yashwerewolf8825
@yashwerewolf8825 Рік тому
Ghost rider is one of the best and most underrated comic book character ever... Nic Cage was dope .. I've seen this movie in theatre and it's nuts..🔥
@anuvindm2092
@anuvindm2092 Рік тому
7:50 Now That's what we call a brilliance
@jayyoo1794
@jayyoo1794 10 місяців тому
This is is all about the design. Ghost rider looks metal as hell.
@sanskarsharma1138
@sanskarsharma1138 8 місяців тому
From childhood always my fav movie but those dialogues i undrstood now , its really humourous 😂 like hows my driving written on truck after hitting GR 😂 and many instances i still laugh like hell 🤣🤣🤣 he was the deadpool of that time i must say most badass 😂
@soupsock9743
@soupsock9743 Рік тому
"You're going down!" "I don't think so" 10/10 performance right there
@deadpool3466
@deadpool3466 Рік тому
🥫🥫
@leakedclipsdaily
@leakedclipsdaily Рік тому
This guy has all this power but can't do it himself? Johnny has a point.
@ashirvadin
@ashirvadin Рік тому
That's because it's not Mephistopheles's power. The Ghost Rider is Zarathos who is just under the control of Mephistopheles almost like a pet predator.
@tormentor2285
@tormentor2285 Рік тому
mephistopheles was always quite limited almost everywhere, he follows strictly his code, and it works
@Klimbo93
@Klimbo93 Рік тому
Say again, USA vs Russian every conflict last century?
@jeepamir508
@jeepamir508 Рік тому
The thing is Mephistopheles limited on Earth with his powers. That's why he needs Rider
@Mash3OH3
@Mash3OH3 Рік тому
The Ghost rider is pretty much what the Silver Surfer is to Galaxtos A supernatural herald lol
@DBfan106
@DBfan106 Рік тому
Even after all these years, this movie is still just SO FREAKING COOL! Don't care how old I get Ghost rider will always make me smile!
@harryguidotti3815
@harryguidotti3815 Місяць тому
This is definitely up there on my list of favorite transformations.
@RAY.POLARIS
@RAY.POLARIS Рік тому
4:30 the cops was like" Okay I got it I won't be trying to catch him otherwise I'll make a fool out of myself"!😂
@Darthrevanthedarklord
@Darthrevanthedarklord Рік тому
@@synophobia876 Tengen?
@louisrobitaille5810
@louisrobitaille5810 Рік тому
My favorite part of the whole movie is definitely this scene at 6:55. Wes Bentley's expressions are perfect with the Ghost Rider's punch lines :D
@Artvy1
@Artvy1 8 місяців тому
And Peter Fonda is marvelous in his acting as Mephistopheles!
@cold_tn4890
@cold_tn4890 10 місяців тому
Finally I funny UKpostsr that goes straight into the clip thank you this is my favorite movie
@JarvisBaileyVA
@JarvisBaileyVA Рік тому
A lot of people with myself included give Nic Cage credit for this scene and rightfully so. He's not so up his own ass that he's above going over the top and goofy for a transformation into an insane flaming demon.
@welovephilippineswithmylov5419
@welovephilippineswithmylov5419 Рік тому
😱
@sweetpsycho2022
@sweetpsycho2022 Рік тому
😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱
@lukahmad5683
@lukahmad5683 Рік тому
That CG was great knowing that they did this in 2007, I love this movie. Hope they have variant of Cage's Johnny Blaze in MCU.
@momotow8286
@momotow8286 10 місяців тому
i was blown away 10 years ago, and I am blown away now....
@Xientiqq_Society
@Xientiqq_Society 5 місяців тому
Aside from pirates of the Caribbean series this is my best movie as a kid and even now. I just love all of it I can’t even cap
@fin9365
@fin9365 Рік тому
7:02 me confronting my cat on the counter at 3 AM eating the bread bag
@edd4816
@edd4816 Рік тому
Your cat: "We're not going to have a meaningful conversation now are we?"
@darrenwallis7630
@darrenwallis7630 Рік тому
4:26 i feel they missed a trick the speed gun should’ve recorded 666
@brianmason8400
@brianmason8400 Рік тому
Hahahaha... nice one !
@Luis-tz8kt
@Luis-tz8kt Рік тому
speed gun can’t track anything above 300 range
@darrenwallis7630
@darrenwallis7630 Рік тому
@@Luis-tz8kt like this movie follows any like of logic or realism?
@alcoholically4280
@alcoholically4280 Рік тому
This movie and their *ODD* finger pointing thing is hilarious. Still love this movie foreverrrr
@Tenshi-Quinn
@Tenshi-Quinn 8 місяців тому
If you watch the whole sequence of him doing a 'pop-o-wheelie' @3:54 and watch it at 0.25x speed - you will see it was Tom Cruise who did the bike stunt for Nick Cage.
@MeesumAliAbbasi
@MeesumAliAbbasi Рік тому
Ghost Rider & Nicholas Cage was perfect combination....no one can execute this role except Cage.
@1motorcitychop
@1motorcitychop 9 місяців тому
Keanu Reeves says hold my 🍺 😂😂😂 🍺
@VERGILGASM
@VERGILGASM 8 місяців тому
​@@1motorcitychopI don't think he'd accept
@jigzyonline
@jigzyonline Місяць тому
​@@1motorcitychopyes with his monotone ass voice. He couldn't do this.
@och1443
@och1443 Рік тому
6:23 normal tuesday for nicolas cage
@Luqmanabdullahsani299
@Luqmanabdullahsani299 Рік тому
6:33 that evil laugh while trasnforming is iconic
@The97Moose
@The97Moose 7 місяців тому
Couldn't put my finger on it, but I love how Mephisto, Blackheart, and The Hidden (Abigor, Gressil, and Wallow) talk in their normal voices, but you can hear the demonic background speech under their breath.
@Dele-Deli
@Dele-Deli Рік тому
6:42 i like when he puting his head up while the music plays
@krkMuse
@krkMuse Рік тому
Nick may be the greatest actor alive today. From performance to keeping his life in check and keep his private life private, a true gift for mankind.
@bananatiergod
@bananatiergod Рік тому
Dude spends thousands of dollars on the craziest shit left and right and ends up with insane debts he has to pay with his movies. Can't call that 'keeping his life in check' LMAO He is a pretty chill dude tho, and I love his mindset on acting. Definitely an interesting guy.
@j.calvert3361
@j.calvert3361 Рік тому
He did quite a lot of lame movies and some outright trash ....
@sarcasticguy4311
@sarcasticguy4311 Рік тому
Said nobody ever.
@zulkamal9191
@zulkamal9191 7 місяців тому
The bike transformation is the best..very nice Cgi..
@legendmaster5394
@legendmaster5394 6 місяців тому
9:33 cool 🔥
@rotoz4life664
@rotoz4life664 Рік тому
6:33 is me when i finally get the last kill on fortnite😂😂
@jhay3966
@jhay3966 Рік тому
7:16 ahhh yes. . . Air, Water, and truck driver
@johnbelgium6814
@johnbelgium6814 Рік тому
The ominous mysterious music before his transformation, love when movies do that
@jodyreeder4820
@jodyreeder4820 3 місяці тому
Still love this
@all4cyrus
@all4cyrus Рік тому
I love the way the bike just threw him in the garage as if to say "we gotta do something about that skin John".
@commanderrockwell
@commanderrockwell 7 місяців тому
This movie is so freaking awesome. GREAT ACTORE JUST ABSOLUTELY AMAZING
@NateDogg8866
@NateDogg8866 Рік тому
“Please, have mercy” Bro you just hit me with a semi
@secretgarden3555
@secretgarden3555 3 місяці тому
Nicolas Cage at his best.❤‍🔥
@Artvy1
@Artvy1 8 місяців тому
This is definitely my most favorite movie with the marvelous Actor - Nicolas Cage!
@Luka2000_
@Luka2000_ Рік тому
Man I wish that we got an r rated ghost rider movie. This was a good movie but it sadly went unnoticed
@Masked_SVincent
@Masked_SVincent Рік тому
I think the writing and storyline could’ve been done better, but I def don’t thinks it’s as bad as people make it to be
@jackratscratpack9323
@jackratscratpack9323 Рік тому
Doesn’t need to be r rated don’t need blood with ghost rider he leaves nothing but ash and brimstone and charred skeletons
@FortniteDad39
@FortniteDad39 Рік тому
Thanos (to Thor): You should've gone for the head Ghost Rider (puts hand on Thanos shoulder): Hey...Dirtbag....
@tamilpasanga8322
@tamilpasanga8322 7 місяців тому
Still gives me goosebumps
@Panzer_John
@Panzer_John 2 місяці тому
You wont believe the happiness I got from watching this
@mulamuerastus9140
@mulamuerastus9140 Рік тому
That scene where horse ghost rider & cage go for a ride always gave me goosebumps as a teenager..Movie was great for the 2000s ..But also I felt like it went downhill after the first movie
@cristianpreiti119
@cristianpreiti119 Рік тому
I VERY MUCH AGREE WITH YOU,MULAMU....
@radheybharadwaj5431
@radheybharadwaj5431 Рік тому
That whistle at 09:07 😵
@janethmuganyizi3155
@janethmuganyizi3155 7 місяців тому
Cartoons...
@Snake-bj2gl
@Snake-bj2gl Рік тому
I remember seeing this transformation scene for the first time on the big screen. I went NUTS over this. I thought that it was one of the most EPIC scenes EVER!!!!! I was like "HOLY SHIT!!!!!!!!!"
@MiyaTakamura
@MiyaTakamura 5 місяців тому
Jason Momoa and everyone involved in making Fast X: Have Mercy. Me: (8:29) Sorry, All Out Of Mercy!
@dmitriciccarelli4082
@dmitriciccarelli4082 Рік тому
Love how the bike has its own personality and mind of it's own.
@millionfps
@millionfps Рік тому
i love nicolas cage as johnny great acting you can see how johnny is getting high in the power until he looks at his hands and he realizes hes burning, power and fear fight and fear dies sheeesh i hope we see him again
@lemhanback9595
@lemhanback9595 8 місяців тому
Not to mention that bike metamorphosis was killer. To bad they changed the bike in the second one 😂😂😂😂
@ajeesh8323
@ajeesh8323 2 місяці тому
I love this movie. Its awesome.
@icheko2498
@icheko2498 Рік тому
8:57 and that kids, is where gravel comes from
@abhishekbarua360
@abhishekbarua360 Рік тому
Damn i want cage back as the hellrider like toby & andrew
@kunalapte5816
@kunalapte5816 Рік тому
Yeah, probably something like a mentor/guide for Robbie as he had Carter Slade for him and maybe even have him transform into the blue rider we saw at the end of SoV.
@abhishekbarua360
@abhishekbarua360 Рік тому
@@kunalapte5816 agreed brother🙌
@Cerdo_asqueroso
@Cerdo_asqueroso Рік тому
Nicholas Cage should never ever be ghost rider. The only reason why he was in this role was because he annoyed the director day and night to get the role, but that role was supposed to be for Jhonny Depp.
@alecrocksablegaming
@alecrocksablegaming Рік тому
@@Cerdo_asqueroso looks like someone doesn’t have taste and is butthurt what’s wrong dad didn’t give you any attention when your younger?
@garvitchauhan6265
@garvitchauhan6265 Рік тому
@@Cerdo_asqueroso Just because he was a big fan of Ghost Rider and who doesn't want to be a superhero? I always thought that Nic Cage was good but the writing and direction of the movies were bad.
@ethanwright3626
@ethanwright3626 10 місяців тому
Underrated movie 💯
@audax117
@audax117 Рік тому
7:50 the camera work, the heavy footsteps, the "whatever" edgelord expression, the cheesy one liner, the green/blue color scheme. This all screams early 2000's and I love it lmao
@Luka2000_
@Luka2000_ Рік тому
This literally came out in 2007 wtf are you talking about
@gustavopereira4924
@gustavopereira4924 Рік тому
@@Luka2000_ 2000's means movies from 2000 to 2009 fucker
@audax117
@audax117 Рік тому
@@Luka2000_ Exactly? 2007 is still early 2000's
@houstonhelicoptertours1006
@houstonhelicoptertours1006 Рік тому
@@audax117 No. Stop huffing glue.
@Luka2000_
@Luka2000_ Рік тому
@@audax117 literally toilet brain
@bossnationn975
@bossnationn975 Рік тому
Demon: have mercy Rider : ooh at of mercy. That line.. Madddd
@minatothefaster1788
@minatothefaster1788 Рік тому
Sorry All outta mercy 😄
@law500
@law500 Рік тому
Everything about ghost rider is amazing
@warrenmccormackjnr4813
@warrenmccormackjnr4813 Місяць тому
awsome ghost rider absolutly awsome
@greggillings9454
@greggillings9454 Рік тому
@8:46 his human scream muffled by the demon scream is terrifyingly good! Gives you a sense of how powerful the rider is. Granted I don't know much about the history of Ghost Rider. So I don't know how powerful he really is.
@losever1177
@losever1177 Рік тому
He is strong that he beat doctor strange by just staring at him and fight the avengers by himself alone and beat galactus by staring at him.
@AgroFro
@AgroFro Рік тому
He's pretty op
@amarson2322
@amarson2322 Рік тому
ghost rider could solo the entire avengers pretty ez, thats how powerful he is. If he joined MCU there would be no need for Endgame cause he would kill thanos by staring at him3
@Emirthemarvelfanboi
@Emirthemarvelfanboi 3 місяці тому
​@@losever1177 really? Do you know the comics name? I want to read it, because it sounds very cool 😂
Jail Fight Prison Break | Ghost Rider (2007)
7:29
NOW PLAYING
Переглядів 11 млн
Ghost Rider Defeats Blackheart | Ghost Rider | Voyage
10:16
Voyage
Переглядів 20 млн
😱СНЯЛ ФИКСИКОВ НА КАМЕРУ‼️
00:35
OMG DEN
Переглядів 1,4 млн
Эффект Карбонаро и соковыжималка
01:01
История одного вокалиста
Переглядів 1,2 млн
Teenagers Show Kindness by Repairing Grandmother's Old Fence #shorts
00:37
Fabiosa Best Lifehacks
Переглядів 11 млн
RoboCop: Protect The Innocent
21:49
KBGiantsfan
Переглядів 8
Johnny Blaze Sells His Soul (First 10 Minutes) | Ghost Rider 2007
9:57
The Mummy Trilogy's Best Scenes
25:33
Movieclips
Переглядів 93 тис.
'Come With Me If You Want To Live' Scene | Terminator 2: Judgment Day
8:50
Tina and Mask on the date | The Mask
4:31
Flashback FM
Переглядів 24 млн
The Dragon Warrior Tournament | Kung Fu Panda (2008) | Family Flicks
5:20
Ghost Rider Evades The Cops | Ghost Rider | Voyage
5:35
Voyage
Переглядів 10 млн
X-MEN ORIGINS: WOLVERINE CLIP COMPILATION (2009) Hugh Jackman
9:52
JoBlo Movie Clips
Переглядів 21 млн
Приложи Сюда Палец 😁 @NutshellAnimations
0:31
Глеб Рандалайнен
Переглядів 2,7 млн
Bemax Reactions
1:00
Bemax - ベマックス
Переглядів 11 млн