THIS IS THE SCARIEST FAZBEAR’S FRIGHTS EVER... FNAF The Horror Attraction by Battington

  Переглядів 153,074

Dawko

Dawko

2 місяці тому

Leave a like if you enjoyed today's video! Lots of love!
• The Horror Attraction
Become a Dawkbro!
hex.store/
/ dawkosgames
/ dawkosgames
/ lewis_dawkins
USE CODE DAWKO AT GFUEL CHECKOUT FOR A DISCOUNT! gfuel.ly/31AcTEM
Discord: discordapp.com/invite/dawko
MERCH: dawko.teemill.com/
NINDAWKO - / @nindawko
Join this channel to get access to perks:
/ @dawko
#fivenightsatfreddys
#fnaf

КОМЕНТАРІ: 713
@Battington
@Battington 2 місяці тому
Thank you so much for the support! Big shout out to everyone who contributed to the video.
@Boigbauttp
@Boigbauttp 2 місяці тому
Where is the behind the scenes
@amanammer
@amanammer 2 місяці тому
everyone did an amazing job!
@graffivids2460
@graffivids2460 2 місяці тому
Yes come on, how did Dawko not find and pin this?!
@MonkeyOnWheels72
@MonkeyOnWheels72 2 місяці тому
Great job battington!
@yeahok8259
@yeahok8259 2 місяці тому
Awesome work as usual man!
@MoltenVR_
@MoltenVR_ 2 місяці тому
Neat little fact, ever time George goes down the drop, the cameras time go's back too 24mins, indicating a potential loop in his mind, maybe because he may have passed out during the first malfunction. This can possibly be further proven when he says: "This most likely isn't real" Edit: The comments be wild
@Iguanodon-fb7rs
@Iguanodon-fb7rs 2 місяці тому
lol Hazbin fan spotted
@1orenzius
@1orenzius 2 місяці тому
"hell is forever whether u like ir or not" 🔥🔥
@Black_Gru
@Black_Gru 2 місяці тому
Meh, Hazbin was completeley mid. The things that ruined it the most is the pacing and the kids watching it….
@Iguanodon-fb7rs
@Iguanodon-fb7rs 2 місяці тому
@@Black_Gru I loved it
@SleepyKnight-sx7po
@SleepyKnight-sx7po 2 місяці тому
Also his battery fills back up
@feral0549
@feral0549 2 місяці тому
Anyone notice when Phone Dude announced during the ride he mentioned a Code Yellow? That is typically for gas leaks or chemical spills. George could have been hallucinating the entire time, driving him mad until he eventually gets hit by the cart.
@corruption2681
@corruption2681 2 місяці тому
Code yellow refers to a missing person, george was the corpse referred to at the beginning.
@corruption2681
@corruption2681 2 місяці тому
He started existing out of time.
@aldiascholarofthefirstsin1051
@aldiascholarofthefirstsin1051 Місяць тому
Don't spread misinformation.
@feral0549
@feral0549 Місяць тому
@@aldiascholarofthefirstsin1051 Just a theory.
@aldiascholarofthefirstsin1051
@aldiascholarofthefirstsin1051 Місяць тому
@@feral0549 It's not a theory, it's literally a wrong fact.
@Horroraddict666
@Horroraddict666 2 місяці тому
maybe George was the "Dead person" that was rumored in the beginning by his friends, his soul was grounded there in that loop and basically in the beginning it actually happened before he died BUT when Vanessa was screaming for him, she was screaming for someone to help her because George died🤯
@ParanoidHunters
@ParanoidHunters 2 місяці тому
That could be. He could be assumed dead since they didnt find him. Kinda like no clipping.
@Horroraddict666
@Horroraddict666 2 місяці тому
@@ParanoidHunters true!
@THICCsuki
@THICCsuki 2 місяці тому
I like the theory, but what is understood was referring to Springtrap
@WildcatGambit
@WildcatGambit 2 місяці тому
i rly like this idea, no wonder he couldn't go with his friends at the beginning!
@Horroraddict666
@Horroraddict666 2 місяці тому
@@WildcatGambit thanks!🫶
@_shelby.mason_
@_shelby.mason_ 2 місяці тому
"imagine the SMELL?! that's so DisGUstINg" with the voice had me so dead💀
@MrSprings355
@MrSprings355 2 місяці тому
Like the way she said it had like sassy girl 2000s vibes
@jfdgbfjlttkntg
@jfdgbfjlttkntg 2 місяці тому
i love it
@Frozzfire_Blackheart
@Frozzfire_Blackheart 2 місяці тому
He sounds one of those tik tok material sassy gworl (even tho i dont like those people but i love how dawko just use that voice for out of context)
@HarmonyHowlette
@HarmonyHowlette 2 місяці тому
Sounded like dawkos voice for Monika in his ddlc playthrough
@KingGodzillaTM
@KingGodzillaTM 2 місяці тому
Valley girl accent yeah pff
@Immortal_Ninja
@Immortal_Ninja 2 місяці тому
My guess is that George got stuck in a pocket of time after he got on the ride and thus time would naturally pass while George was stuck in the looping ride. By the time he "escaped", he was in the dead and dilapidated location that had been evacuated during a police investigation.
@ParanoidHunters
@ParanoidHunters 2 місяці тому
I think vanessa is some sort of trick as well.
@SymphonyOfTheMind.
@SymphonyOfTheMind. 2 місяці тому
I thought this too, seems the most oogival
@MannequinMonarch
@MannequinMonarch 2 місяці тому
That or he may have very well still been in some form of alternate reality or pocket location. I personally like to think about it like if FNaF had it’s own take on the Upside Down or Back Rooms. Entirely isolated, making it even scarier for anyone inside. Also means his body would NEVER be found, much like the poem in the original video’s description describes. Though that’s just my theory/head canon, I just like that idea as it is way more chilling and scary to me, the isolation and helplessness of it.
@bradley2468
@bradley2468 2 місяці тому
This reminds me of into the pit
@thefantasticretroreviewer3941
@thefantasticretroreviewer3941 2 місяці тому
18:49, If I saw THAT freaky thing in the same spooky Hallway, I'd be so scare and run so fast that I would make Superman, The Flash, Road Runner, Speedy Gonzalas and Speed-Buggy look like slow Snails.
@ParanoidHunters
@ParanoidHunters 2 місяці тому
Just stay off the tracks you be good :)
@thefantasticretroreviewer3941
@thefantasticretroreviewer3941 2 місяці тому
@@ParanoidHunters Seems like decent advice to me
@bbseal
@bbseal 2 місяці тому
what about sonic
@thefantasticretroreviewer3941
@thefantasticretroreviewer3941 2 місяці тому
@@bbseal Him too
@shadowphantom5407
@shadowphantom5407 2 місяці тому
what about quick sliver?
@Electricstarzsh0ckt0533m3
@Electricstarzsh0ckt0533m3 2 місяці тому
The fact that it says “HurricaneHaunt”, it felt like it’s connected to the Novel trilogy
@thegodzillafandomsrookie5514
@thegodzillafandomsrookie5514 2 місяці тому
or its just because both the series and games take place in hurricane utah
@MemeReviewer
@MemeReviewer 2 місяці тому
Surprised Battington didn’t register a domain for that
@addison_v_ertisement1678
@addison_v_ertisement1678 2 місяці тому
​@@MemeReviewerDomain Expansion: Hurricane Haunt.
@Reseptics
@Reseptics 2 місяці тому
​@@addison_v_ertisement1678why does this actually go hard?
@MemeReviewer
@MemeReviewer 2 місяці тому
@@addison_v_ertisement1678 yay!
@JessRedMusic
@JessRedMusic 2 місяці тому
The detail I love about this is when he goes into the drop, you can see the timer on the camera go back to the 20 minutes. To show that he did go back in time to relive the ride over and over and over again
@ParanoidHunters
@ParanoidHunters 2 місяці тому
I wonder how long he was there. Two - three hours?
@Candy_Kitsune
@Candy_Kitsune 2 місяці тому
Feels like a reference to when you shoot Helpy in Foxys Pirate Adventure. It goes down a path that you're not meant to say and then goes back to the beginning
@sushifox0
@sushifox0 2 місяці тому
My theory is that he DID go in, but the sort of “loop” that he was put in didn’t share the same time as the outside world. I could also see the use of illusion discs playing into this animation, but maybe I’m just yapping lmao
@ParanoidHunters
@ParanoidHunters 2 місяці тому
Somthing going on for sure cause that ride became somthing else.
@e-pointer2262
@e-pointer2262 2 місяці тому
Nah illusion disks make sense unless the ride really does have a shtick of feeling like a loop
@lmaobox4068
@lmaobox4068 2 місяці тому
It's good to note the areas that the giant golden Freddy head and black goop appear in are the only areas not affected by the building’s blackout Illusion disks deactivated in most of the building except for those areas explicitly with power?
@kaIamos
@kaIamos 2 місяці тому
Wait a minute, George's friends said a body was found on opening day. And we can tell that George is time travelling because of the time on the camera, so what if George was brought to the opening day and became the corpse found on opening day?
@anothernrg8274
@anothernrg8274 2 місяці тому
Most likely, We NEED DAWKO TO SEE THIS, everyone, Like @kalamos 's comment!
@gamejitzu
@gamejitzu 2 місяці тому
I haven't seen an idea like this, yeah it could've been really clever seeding. And if the black goop from Golden Freddy was agony, combined with time travel, this is like an Into the Pit situation Edit: oh :v
@Yayofangamer16
@Yayofangamer16 2 місяці тому
The description of the video debunks this
@kaIamos
@kaIamos 2 місяці тому
@@Yayofangamer16 Hence the what if.
@aldiascholarofthefirstsin1051
@aldiascholarofthefirstsin1051 Місяць тому
@@kaIamos What if I made a theory that is completely wrong and then act like a coward when I face absolute facts that debunk it.
@tm0410
@tm0410 2 місяці тому
18:49 I love how this is a reference to golden freddys head in the hallway in fnaf 2, I remember being terrified the first time I saw that in fnaf 2
@kingcleeetus3587
@kingcleeetus3587 2 місяці тому
Freddy Fastbear
@GooberProducer
@GooberProducer 2 місяці тому
Fried rice at dennys
@whocaresaboutthename6850
@whocaresaboutthename6850 2 місяці тому
Har har har har har har har (Green Hill Zone Theme).
@PurpleBoi69
@PurpleBoi69 2 місяці тому
According to his Girlfriend
@izvayl
@izvayl 2 місяці тому
@@PurpleBoi69hello
@THE_222
@THE_222 2 місяці тому
@@GooberProduceris this where you wanna eat!
@kendgie_245
@kendgie_245 2 місяці тому
When it said code yellow (aka, a missing person) I immediately was like, "Oh, George so got trapped in a time loop and is now missing"
@ElizabethLopez-un8ow
@ElizabethLopez-un8ow 2 місяці тому
Out of all the vhs tapes this one was the most unsettling one too date
@Sam-ck6wh
@Sam-ck6wh Місяць тому
Yeah,I couldn't even watch it on my own,it felt to unsettling to even watch on my own in the day,I only got as far as the third loop before I felt too unsettled to watch😅
@iimd_pll
@iimd_pll Місяць тому
fr dude 😭idk why this one was just so scary, i had to keep pausing
@Jumpyman_thegamerYT
@Jumpyman_thegamerYT 2 місяці тому
Notice that the time on the camera footage actually goes back each time. It keeps re-setting. This time just shows how long he's been recording for, and isn't what the time currently is obviously. Meaning that the time loop is physically altering the camera footage itself.
@ParanoidHunters
@ParanoidHunters 2 місяці тому
Yes and the power as well.
@kory_misun
@kory_misun 2 місяці тому
Xander's voice acting was absolutely fantastic. I was genuinely afraid for him once things started twisting and becoming more dire.
@ParanoidHunters
@ParanoidHunters 2 місяці тому
It was very good. I thought the guy was a bit crazy but then im like yeah this is a bas situation.
@kory_misun
@kory_misun 2 місяці тому
@@ParanoidHunters Yeah, we're not told how long he's stuck in there for. I'd become unhinged pretty quickly if I couldn't get out and no one came to find me. Meanwhile I know I'm not alone and the robots move.
@ashtrro
@ashtrro 2 місяці тому
I genuinely felt this anxiety while watching this bc typically in horror it works best when you feel for the protagonist and he just did not deserve that lol
@ParanoidHunters
@ParanoidHunters 2 місяці тому
Yeah it gets worse and worse.
@GlitchyBoy64
@GlitchyBoy64 2 місяці тому
1:50 Dawko really went 😜💅👄💀 (The eyes in spring bonnie from the fazbrar frights logo send chills down my spine)
@ParanoidHunters
@ParanoidHunters 2 місяці тому
yeah it is crazy
@egg_head_defore
@egg_head_defore 2 місяці тому
its a good design lol.
@THICCsuki
@THICCsuki 2 місяці тому
I love that design too
@Crystal_959
@Crystal_959 2 місяці тому
I don't think the protagonist was hallucinating. Every time George loops back to the start of the ride, the camera's display jumps back to how it was when he entered. We're watching through the camera's perspective, not George's. He got sucked into like, some weird pocket dimension or something. It states in the description that no one ever found him no matter how hard they searched
@giuliobros.123
@giuliobros.123 2 місяці тому
Battington really knows how to make things terrifying
@ParanoidHunters
@ParanoidHunters 2 місяці тому
super terrifying
@tristanribeiro7903
@tristanribeiro7903 2 місяці тому
As I said in the comments from Batington's video, the concept could work as a potential new Fazbear Frights story : a loop where someone is stuck in an attraction, and can't escape. I love this video, Batington nailed it 👌
@ParanoidHunters
@ParanoidHunters 2 місяці тому
It was great. I would never go there lol
@tristanribeiro7903
@tristanribeiro7903 2 місяці тому
​@@ParanoidHunters i mean, I'm sure that people are clever enough to avoid places like this for urbex.
@pupulauls
@pupulauls 2 місяці тому
Code yellow is typically a code for a missing person. George goes missing part way through the ride and is the reason it stops. The ghost of Springtrap somehow makes his body disappear while he torments him in a loop. He almost acts like Pennywise in this video, and spends most of the time making George more and more scared like the more fear he has the more satisfying the kill will be. Might be on purpose considering Georgie is probably the most famous victim of Pennywise. Also I love the big Golden Freddy head as a reference to FNaF 2 as well as the broken Toy Animatronics
@NekoPatty06
@NekoPatty06 2 місяці тому
That giant head made me stay up all night because of how terrifying it was
@kudvin101
@kudvin101 Місяць тому
i love how everytime he loops the video time goes back to 24 minutes, it's a nice little detail
@Yumais
@Yumais 2 місяці тому
Scott needs to hire Battington asap, his videos are just too well done and he's too talented to go unused.
@yeahok8259
@yeahok8259 2 місяці тому
Yeah! And not even just because of his editing/modeling skills, but the dude is a very talented writer/director
@aldiascholarofthefirstsin1051
@aldiascholarofthefirstsin1051 Місяць тому
Hire him for what? The video games are real time 3D, there is nothing Battington can do.
@Tarokun874
@Tarokun874 2 місяці тому
21:13 George: WHY WONT YOU LET ME LEAVE springtrap: answer: ATZJDDKHTSKSKRGFHKWSHFKKHFKWWFSHRLHRSYRSRTSRHSRMYSHRS i mean he has a point
@Orange-inkling
@Orange-inkling 2 місяці тому
Agreed
@bubblepopva
@bubblepopva 2 місяці тому
Thank you so much for reacting, Dawko! I had a blast voicing Vanessa and Jessica! ❤❤
@Cruisvfixz
@Cruisvfixz 2 місяці тому
18:48 "You want fun?" "Fredbear will show you fun"
@Marshmo
@Marshmo 2 місяці тому
Battington never misses, I love videos like these
@ParanoidHunters
@ParanoidHunters 2 місяці тому
This one is so complex. Could start doing full movies soon.
@thundertits
@thundertits 2 місяці тому
I like how this one felt like a fazbear frights books
@ParanoidHunters
@ParanoidHunters 2 місяці тому
It did.
@yeahok8259
@yeahok8259 2 місяці тому
I commented the same thing on the OG vid! I wish more creators did stuff like this
@Xzyzkw
@Xzyzkw 2 місяці тому
At 16:07 you can see a shark animatronic at the right which I think is Felix the Shark which is a pretty cool easter egg
@ParanoidHunters
@ParanoidHunters 2 місяці тому
Thanks that was a cool find.
@Xzyzkw
@Xzyzkw 2 місяці тому
@@ParanoidHuntersIt makes sense as well since presumably the SpringTrap used in the VHS was the one from the books.
@ThatTazVEVO
@ThatTazVEVO 2 місяці тому
From what I think there are a few reasons to why the ride repeats and then kills George: 1. Springtrap uses the illusion disks to trick and alter Georges perception to make it feel like he's repeating the line over and over, which I think is cool because it turns Springtrap from a basic killer in suit to like a Mysterio from the Spider-Man comics; someone who can alter others perception with basic smoke and mirror tricks to twist their minds. Maybe William Afton sees Mike in George so that's why he hunts him. 2. It's the ghost of the children taking back the ride that makes fun of their deaths, which there are multiple references to previous VHS tapes that only Mike would've seen such as Chica's lovely song, Foxy meets the happy man & others. So imagine the hate the animatronics feel towards the ride that pokes fun at their death but then again why would they target George for no reason. 3. It's a farm for Remnant made by followers of William Afton. I'm saying this cuz there's references to Glitchtrap on the wall in the FNAF 2 room and one of the characters being named Vanessa. This is the most far fetched theory but imagine if followers of Glitchtrap created a harvester of Remnant (I have no idea how Remnant works I'm just guessing you get it via Monster's INC style but more people's death's not just their screams).
@aldiascholarofthefirstsin1051
@aldiascholarofthefirstsin1051 Місяць тому
4. The yellow rabbit has reality altering powers, something that people really don't say for some reason, despite the other incredible parts of the story such as robots inhabited by ghosts.
@D0CT0RRABB1T
@D0CT0RRABB1T 2 місяці тому
19:12 well,, Afton sure knows how to make a horrifying entrance 😭
@jakecookie5448
@jakecookie5448 2 місяці тому
Being trapped in loop is something scary to be in especially when something alive in there while watching friends get killed in there😓
@ParanoidHunters
@ParanoidHunters 2 місяці тому
The guy is legit upset. I would be as well.
@AshishXMC
@AshishXMC 2 місяці тому
The Huge Yellow Bear Head is basically me when I am about to have a bigger size of my favorite food.
@ParanoidHunters
@ParanoidHunters 2 місяці тому
And then a rabbit comes out? :D
@AshishXMC
@AshishXMC 2 місяці тому
@@ParanoidHunters Yeah, I guess when I eat an egg sandwich, but they used boiled eggs, having no idea that whatever was forming inside before, was already formed.
@slimeezpizzeria
@slimeezpizzeria 2 місяці тому
this is honestly my favorite fnaf vhs tape i’ve ever watched
@ParanoidHunters
@ParanoidHunters 2 місяці тому
This one had a lot going on.
@SStickystickk
@SStickystickk 2 місяці тому
“iMAgiNe the sMeLl, ItS DisGustiNG”
@ParanoidHunters
@ParanoidHunters 2 місяці тому
Or it smells like pizza
@Timeless_fnaf
@Timeless_fnaf 2 місяці тому
i LOVE the vintage 90's synth horror vibe in that beginning commercial so much. If fazbear freights was real it would 100% look like that.
@rubykaylaandogie3334
@rubykaylaandogie3334 2 місяці тому
"GET ME OF THIS RIDE!!" "Please excuse me sir but would you please escort me from this simple train made for ones enjoyment?"
@Wafflefries-wi5rf
@Wafflefries-wi5rf 2 місяці тому
I have a theory, when he was going back in time years and years past outside the building and it only felt like minutes for him and the reason why police were outside is because his friends must’ve reported it to the police.
@leonardoleal3526
@leonardoleal3526 2 місяці тому
Oh my gosh. What a freaking animation, the sound, the animation, the ambient. Everything about this video is so creepy and so fnaf like. Props to battington and everyone who helped make this video.
@ParanoidHunters
@ParanoidHunters 2 місяці тому
They should start making full movies.
@leonardoleal3526
@leonardoleal3526 2 місяці тому
@@ParanoidHuntersyeah that would be a awesome idea
@bluegold1026
@bluegold1026 2 місяці тому
Love all the callbacks to Battington's previous works. Also, the plot of "The Horror Attraction" would fit right in as a short story in a Fazbear Frights book.
@mightbealvi
@mightbealvi 2 місяці тому
This could actually be a good ride for Universal Studios
@scottypenguinGaming
@scottypenguinGaming 2 місяці тому
youre insane metoo😂
@MikyYT
@MikyYT 2 місяці тому
Springtrap really toyed with his pray
@thefantasticretroreviewer3941
@thefantasticretroreviewer3941 2 місяці тому
Is it William Afton still stuck in that Suit?
@MikyYT
@MikyYT 2 місяці тому
@@thefantasticretroreviewer3941 DUH
@thefantasticretroreviewer3941
@thefantasticretroreviewer3941 2 місяці тому
@@MikyYT Just making sure.......and even in the Suit he is scary
@marcee1487
@marcee1487 2 місяці тому
I didnt know afton was religous.
@DedBoyRyan
@DedBoyRyan 2 місяці тому
@@marcee1487For real.
@balls2132
@balls2132 2 місяці тому
Dawko has a good voice impression 1:50
@wafagdplqs4421
@wafagdplqs4421 2 місяці тому
I always loved fans interpretation of Fazbear Frights because we've never much of the actual attraction in the games. And of course Battington would be perfect for this !
@NifftyTheKiller
@NifftyTheKiller 2 місяці тому
i love how dawko said “tHeReS ya WaRnInG 😂😂😂 dawko is the absolute best person i really hope he gets invited to the fnaf 2 movie set he deserves it 🩷🩷🩷
@ParanoidHunters
@ParanoidHunters 2 місяці тому
If 2 is a prequel that might happen
@bigpoggers6507
@bigpoggers6507 2 місяці тому
Theory: The loop is slowly showing bits of what actually happened to George, he was lured by the spirits into the tracks where he got hit. The "loop" is his memory of the event repeating over and over, distorting and twisting as he dies. The time on his camera resetting is from the memory restarting, with every "Springtrap" instance, when pieced together, displaying what actually happened. He gets on, he goes on the ride, he gets stuck at the section with the toys, the spirits use the Springtrap animatronic to lure him into the backroom, he runs out, with the Springtrap animatronic continuing chase until eventually he gets cornered at the start, causing him to run backwards, where he gets absolutely mollywhopped by a cart. The "turn back" from the Puppet being a warning to not enter the toy room as that's where the backroom entrance is.
@elephantality3753
@elephantality3753 Місяць тому
True, the Freddy Head could have been what he imagined as he was hit by the Freddy Cart. The turn back, I think is just the Puppet telling him to wake up and live... Maybe.
@aldiascholarofthefirstsin1051
@aldiascholarofthefirstsin1051 Місяць тому
Why do people like those boring-uncreative-absolute and objectively garbage dream theories? Is it so hard to you to accept the ghost robot bunny has the ability to put the guy into a time loop? Or a pocket dimension?
@elephantality3753
@elephantality3753 Місяць тому
@@aldiascholarofthefirstsin1051 Doesn't seem likely especially when he leaves and magically is in a cart again. No to pocket dimension.
@aldiascholarofthefirstsin1051
@aldiascholarofthefirstsin1051 Місяць тому
@@elephantality3753 But yes to time loop, right?
@JiggyThe1st
@JiggyThe1st 2 місяці тому
1:50 Never knew I needed Zesty Dawko in my life
@ParanoidHunters
@ParanoidHunters 2 місяці тому
Zesty Pizza Dawko possibly?
@No_James_Here
@No_James_Here 2 місяці тому
I was 13:59 in and I got an ad for Chuck E. Cheese, coincidence?
@ParanoidHunters
@ParanoidHunters 2 місяці тому
they know!!!
@coleminer8847
@coleminer8847 2 місяці тому
A small detail The timer in the top left resets to the time it was at during the start of the ride every loop
@zaknorris2653
@zaknorris2653 2 місяці тому
This is genuinely so cool! The idea that Springtrap is hidden amongst a bunch of animatronics posing as him is so creepy. Especially cause George doesn't even know Williams inside
@Thekrineyesyes
@Thekrineyesyes 2 місяці тому
I would like to point out how when he goes back to the start, the recording length reduces to the same length when he went on the ride in the beginnin. Also the fredbear head that spat out springtrap could have been a phantom. Otherwise amazing vid❤❤
@ParanoidHunters
@ParanoidHunters 2 місяці тому
Good eyes man
@datemmie
@datemmie 2 місяці тому
its funny that the video itself is 23 minutes while fazbear's frights was theorized (idk if its canonical) to take place in 2023
@ParanoidHunters
@ParanoidHunters 2 місяці тому
I bet he was there for hours.
@datemmie
@datemmie 2 місяці тому
@@ParanoidHunters to me, it seems like years.
@PaulIsntMyName
@PaulIsntMyName 2 місяці тому
I was waiting for you to cover this 💪
@smoresx
@smoresx 2 місяці тому
Did you know when the phone guy said code yellow when it first broke down code yellow means a missing rider alert
@gavinjames645
@gavinjames645 2 місяці тому
At this point battington should make their own fnaf fan game 😅.
@xcheeltroncoso2002
@xcheeltroncoso2002 2 місяці тому
I know, right! Can you imagine how it would look like??
@fried_fries
@fried_fries 2 місяці тому
He definitely makes really good analog horror videos, but I don’t know if that would really translate well to a game tbh
@xcheeltroncoso2002
@xcheeltroncoso2002 2 місяці тому
@@fried_fries oh well, a person can dream.. 🙃
@breakingfaffles
@breakingfaffles 2 місяці тому
this whole video felt like a Fazbear Frights story, it feels like the first time reading one of them again for the first time
@juliane.mfarias9285
@juliane.mfarias9285 2 місяці тому
Battintong made the giant Golden Freddy head in the hallway terrifying!!
@bumblefilm
@bumblefilm 2 місяці тому
this really reminds me of the one stargate sg-1 episode where jack, teal'c, and daniel ended up stuck in the same time loop and you can really genuinely see the insanity start to set in, but with a big lack of self awareness. Out of all the tapes battingtons made this has got to be my favorite!!
@tkmikki
@tkmikki 2 місяці тому
they said at the beginning of the video that this was at the washington county fair (which is the actual county Hurricane is in), and I've been there. If this was at the county fair, I would be shocked because, at most, they usually just have like your basic ferris wheel, the one spinning ride, a carousel, and then food and games. not even a spooky ride or tunnel of love. also, props to battington for getting the va for the advertisement at the beginning to say the town name right (its pronounced "her-a-kin")
@ColorMidEditz
@ColorMidEditz 2 місяці тому
Maybe with the drinks he had he hallucinated the place not being abandoned and most likely passed out during the malfunction, waking up to the abandoned place, which was most likely an infinite loop setup by Springtrap. I don’t have any theory about the friends and the big fredbear head.
@elephantality3753
@elephantality3753 Місяць тому
I do. So if we assume he was hit by a Freddy Cart, I think the Freddy Head was what he imagined as he was hit. The blood? His blood, upon being mangled by the cart. Vanessas screams? Her finding George hit, and he understands half of it and as it distorts... his consciousness fades away. I think SpringTrap killed him at the drop, or he died in the room with the malfunction. Also to note, he was the last ride of the night.
@aldiascholarofthefirstsin1051
@aldiascholarofthefirstsin1051 Місяць тому
@@elephantality3753 Garbage theory.
@PELTIER5
@PELTIER5 2 місяці тому
Maybe he died on the ride back then and is now stuck in a sort of hell cycle
@ShadeauxMan
@ShadeauxMan 2 місяці тому
Universal should seriously do something like this! They already have so lit rides! Like the Transformers one! This would be amazing’
@ParanoidHunters
@ParanoidHunters 2 місяці тому
Yes but way less scary lol
@ShadeauxMan
@ShadeauxMan 2 місяці тому
Nah, it’s gotta be terrifying🙏🏻
@magna-zone1219
@magna-zone1219 2 місяці тому
My fav part about battington is how he destroys your preconception of what FNAF is and can be
@nothingrhymeswithorange5294
@nothingrhymeswithorange5294 2 місяці тому
That thumbnail makes Dawki look like he's in an early PS4 game
@ParanoidHunters
@ParanoidHunters 2 місяці тому
Dawki? lol
@ShadeauxMan
@ShadeauxMan 2 місяці тому
Also- I’m probably not right.. but what if George is the one that died- and he’s reliving his death repeatedly-
@ParanoidHunters
@ParanoidHunters 2 місяці тому
Yeah it feels like he is the one that is dead. Kinda like he no clipped and is seeing stuff from the past as he is trapped.
@BatoonyPants
@BatoonyPants 2 місяці тому
Every time he goes down the drop, he could’ve blacked out and when he woke up, William afton kept putting him back at the start, and every time he woke up, he thinks the ride keeps looping, draining his sanity. And by the time he finally gets off the ride, it’s a different year, and he finally gets killed.
@yeahok8259
@yeahok8259 2 місяці тому
This is why I love Battington. Dude is genuinely creative- and the extra detail of green-screening himself into his animations for better human realism is top tier editing as well.
@AlexLazee
@AlexLazee 2 місяці тому
I love this VHS so much.
@AwkwardCat23
@AwkwardCat23 2 місяці тому
Battington my beloved i love his stuff SO MUCH it is my favorite fnaf vhs content, one of my favorite and most quoted videos on the internet is made by him
@ParanoidHunters
@ParanoidHunters 2 місяці тому
I am glad to see a new one
@larrythestoner2449
@larrythestoner2449 2 місяці тому
Battington has once again made a masterpiece with his animations! I absolutely love the amount of detail, acting and story he does. I hope he does more in the future.
@SarahAbramova
@SarahAbramova 2 місяці тому
It's so cool how people just create so many games/videos based on this one franchise!
@ParanoidHunters
@ParanoidHunters 2 місяці тому
It is cool. i like it a lot.
@ThatOneRandomPerson54
@ThatOneRandomPerson54 День тому
This whole tape seems like one of the book stories, like in the Fazbear Fright’s series- Crazy!
@gbird.
@gbird. 2 місяці тому
it would be cool in universal BUT this has clear inspirations from Disneyland haunted mansion/pirates
@ParanoidHunters
@ParanoidHunters 2 місяці тому
Needs more water.
@elephantality3753
@elephantality3753 Місяць тому
I've also noticed that the cart is new and shiny, until the ride breaks down. Then it's old and musty.
@Gojirawars03
@Gojirawars03 2 місяці тому
“It’s freezing in here.” Almost as if they were preserving the corpse…
@Dani-yo
@Dani-yo 2 місяці тому
WHY WONT YOU LET ME LEAVE?! RRRRRRRAAAAAAAAGGGGGGHHHHHHHHHH
@ParanoidHunters
@ParanoidHunters 2 місяці тому
I wonder how long he was there for.
@chipthelightgaia7329
@chipthelightgaia7329 2 місяці тому
Battington is great at making these locations feel actually haunted, not just the animatronics. FNaF Plus Break in had it down perfectly is what I thought before I saw this
@miramaranne5024
@miramaranne5024 2 місяці тому
A fun fact, since it is a time loop, the time and battery go back to what they were when George started the ride.
@facely
@facely 2 місяці тому
I don't understand how he gets transported back to the ride car when he tries to run away. He doesn't even really comment on that when it happens. I'd be beyond freaking out.
@elephantality3753
@elephantality3753 Місяць тому
That to me suggests limbo
@JoaoPedro-ol7sl
@JoaoPedro-ol7sl 2 місяці тому
I think the body mentioned was that person from the other video and he could have died on the first time waiting maybe that's whh Vanessa screams bc she found out he died, or it was springtrap mocking him.
@BlueToons925
@BlueToons925 2 місяці тому
The first time I watched this it scared the hell out of me, glad you enjoyed it too!
@limegreenlive7813
@limegreenlive7813 2 місяці тому
Since George time goes back to 24 four times I've been able to give you the real time he spent in that ride. In reality George spent 1 hour, 23 minutes and 41 seconds...
@superherowolf2444
@superherowolf2444 2 місяці тому
6:26: As long as Lewis and I both got the same feeling of it not being part of the ride
@_lauragull_4178
@_lauragull_4178 2 місяці тому
I was waiting until you posted your reaction!! Battington is so talented😭🔥
@btsfan459
@btsfan459 2 місяці тому
I absolutely LOVE looking at the VHS tapes from FNAF, I love seeing people's creativity, and I've seen some REALLY good ones, they're so cool to look at, and honestly makes me believe that they're real just because of how awesome they are. Love you Dawko, you're an inspiration for me, and really appreciate what you put out to the world 💜💜💜
@ParanoidHunters
@ParanoidHunters 2 місяці тому
I bet a lot of time goes into the story telling than the models. Have to get each shot right over and over.
@btsfan459
@btsfan459 2 місяці тому
​@idHuntersExactly! I agree, the fact that people put so much time and effect into these videos is insane, I love how dedicated people are lmao
@Tarokun874
@Tarokun874 2 місяці тому
1:50 PERFECT 👌 IMITATION
@gavinjames645
@gavinjames645 2 місяці тому
Dawko if you look at the time during the ride it restarts every time he goes down the fall.
@ParanoidHunters
@ParanoidHunters 2 місяці тому
Yeah it goes back like 20 mins
@User-1887
@User-1887 2 місяці тому
Imagine having a dream and being stuck in a loop that would be terrifying
@TacoQueen33
@TacoQueen33 2 місяці тому
Battington has always been so good. I adore their FNAF VHS tapes so much!
@runningthemeta5570
@runningthemeta5570 2 місяці тому
Hell yeah, I saw this and it was so good. I was waiting for either you or Ryan to react to this.
@ParadoxCore18
@ParadoxCore18 2 місяці тому
Finally! So happy that you reacted to the new battington video!
@xaviergarcia5421
@xaviergarcia5421 2 місяці тому
This was really well made. I cannot wait for more battington or other reactions
@fireboytheone
@fireboytheone 2 місяці тому
honestly, i didn’t even notice that the time on the camera resets on each loop on my first watch through. such a cool detail.
@OdensMovieMagic
@OdensMovieMagic 2 місяці тому
Wow.
@EmotionAcid
@EmotionAcid 2 місяці тому
I LOVE YOU DAWKO BUT THE THUMBNAIL FOR THIS VIDEO IS 😭😭😭
@ur_l0c4l_n0nbin4ry_k1d
@ur_l0c4l_n0nbin4ry_k1d 2 місяці тому
I find it funny, a freind of mine did a FNAF DND thing for Halloween (they were the dm, it was really fun) about Security breach having a halloween special where we get locked in and everything goes wrong. I really like the way Battington made the video, it was really cool and well made!
@Trenton-om9qs
@Trenton-om9qs 2 місяці тому
i think George was possibly already dead and he is stuck in a continuous loop. or he was hallucinating the entire time and going crazy.
FNAF HORROR REVIEW 3.0
35:53
Dawko
Переглядів 654 тис.
THE SISTER LOCATION VHS TAPE... - FNAF TUNNEL VISION
18:30
Dawko
Переглядів 127 тис.
Піхотинці - про потребу у людях
00:57
Суспільне Новини
Переглядів 1 млн
одни дома // EVA mash @TweetvilleCartoon
01:00
EVA mash
Переглядів 5 млн
The HORRIFYING FNAF VHS Case of Edward Morris...
12:24
Dawko
Переглядів 163 тис.
I Platinum'd FLATOUT 4. The GRIND for 100% KILLED ME!
14:32
ThaPhey
Переглядів 1,5 тис.
FNAF MOVIE MEME REVIEW
21:30
Dawko
Переглядів 849 тис.
The Moment The FNAF Timeline BROKE
12:12
FuhNaff
Переглядів 99 тис.
BATTINGTON'S TERRIFYING FNAF VHS TAPES...
15:18
Dawko
Переглядів 1 млн
FNAF MEME REVIEW 43.0
14:48
Dawko
Переглядів 216 тис.
FNAF HELP WANTED 2 MEME REVIEW
20:42
Dawko
Переглядів 463 тис.
ПАМЯТЬ КЛЕКСА👿 | WICSUR #shorts
1:00
Бискас
Переглядів 1,8 млн
МАЙНКРАФТ, НО БЕЗ МЫШКИ! | Кэтич
0:52
_кэтич_
Переглядів 420 тис.